Product Image

Contributor Information

  • Name Natasa Skoko
  • Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details

  • Tool name: Human Interferon alpha 2A
  • Alternate names: Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a
  • Tool type: Proteins
  • Tool sub-type: Cytokine
  • Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
  • Source: E.coli
  • Molecular weight of the target: 19.4 kDa
  • UniProt ID: P01563
  • Description: Interferon-alpha (IFN-a) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-a2 is the most potent IFN-a used in fundamental research and in most clinical applications. The best-known IFN-a2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-a modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C.
  • Research area: Cancer ; Immunology

  • For Research Use Only

Target Details

  • Target molecular weight: 19.4 kDa

Application Details

Handling

  • Storage conditions: -20°C
  • Shipping conditions: Dry Ice

Documentation

  • Available on request