PROTEINS
Contributor Information
- Name Natasa Skoko
- Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)
Tool Details
- Tool name: Human Interferon alpha 2A
- Alternate names: Human IFN alpha 2A, IFN-alpha 2, IFNA2, IFNA2a
- Tool type: Proteins
- Tool sub-type: Cytokine
- Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Cellular/ tissue localisation: B cells, Cancer cells, NK cells, T cells
- Source: E.coli
- Molecular weight of the target: 19.4 kDa
- UniProt ID: P01563
- Description: Interferon-alpha (IFN-a) is a type I interferon, produced by virus-infected cells, and is released as a soluble factor to initiate antiviral responses. IFN-a2 is the most potent IFN-a used in fundamental research and in most clinical applications. The best-known IFN-a2 subvariants, 2A and 2B, differ by only one or two amino acids at positions 23 and/or 34 of the mature protein. Type I IFNs exert potent antitumor activity by increasing the cytotoxic activity of NK and T cells, as well as by inhibiting the proliferation of cancer cells. Additionally, it has been shown that proinflammatory IFN-a modulates the function of B cells in patients with systemic lupus erythematosus, and pegylated forms of IFN-alpha 2A and 2B have implications in the treatment of hepatitis C.
- Research area: Cancer; Immunology
- Animal free: Yes
- Additional notes: Lys at position 23
- For Research Use Only
Target Details
- Target molecular weight: 19.4 kDa
Application Details
- Application notes: Molecular Weight: 19.4 kDa UniProt number P01563 (Lys at position 23)
Handling
- Storage conditions: -20°C
- Shipping conditions: Dry Ice
Documentation
- Available on request
.svg)
.svg)
