Product Image

Contributor Information

  • Name Natasa Skoko
  • Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details

  • Tool name: Human Granulocyte Colony-Stimulating Factor (GCSF), Recombinant Protein
  • Alternate names: Human Granulocyte colony-stimulating factor, Colony-stimulating factor 3, CSF-3, MGI-1G, Pluripoietin
  • Tool type: Proteins
  • Tool sub-type: Cytokine
  • Sequence: MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
  • Molecular weight of the target: 18.8 kDa
  • Expression system: Recombinant
  • UniProt ID: P09919-2
  • Description: Granulocyte colony-stimulating factor (G-CSF) is a member of the CSF family of glycoproteins that regulate hematopoietic cell proliferation, differentiation, and function. It is a key cytokine involved in the production of neutrophils and the stimulation of granulocyte colony formation from hematopoietic progenitor cells. G-CSF causes a range of effects including a transient reduction of SDF-1 expression, the activation of metalloproteases that cleave VCAM-1, and the release of norepinephrine from the sympathetic nervous system, leading to the release or mobilization of hematopoietic stem cells from the bone marrow into the periphery. The G-CSF receptor is expressed on a variety of hematopoietic cells, including myeloid-committed progenitor cells, neutrophils, granulocytes, and monocytes. In addition to hematopoietic cells, G-CSF is also expressed in cardiomyocytes, neuronal cells, mesothelial cells, and endothelial cells. Binding of G-CSF to its receptor leads to activation of the JAK/STAT, MAPK, PI3K, and AKT signal transduction pathways.
  • Research area: Neurobiology ; Stem Cell Biology

  • For Research Use Only

Target Details

  • Target molecular weight: 18.8 kDa

Application Details

Handling

  • Storage conditions: 4°C
  • Shipping conditions: Dry Ice

Documentation

  • Available on request