Product Image

Contributor Information

  • Name Natasa Skoko
  • Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details

  • Tool name: Human Erythropoietin beta (EpoB), Recombinant Protein
  • Alternate names: Epoetin, Erythropoietin, EP
  • Tool type: Proteins
  • Tool sub-type: Cytokine
  • Sequence: APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
  • Cellular/ tissue localisation: Hematopoietic Stem and Progenitor Cells, Mesoderm, PSC-Derived, Pluripotent Stem Cells
  • Source: Pichia pastoris
  • Molecular weight of the target: 18.4 kDa
  • Expression system: Recombinant
  • UniProt ID: P01588
  • Description: Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.
  • Research area: Stem cell biology
  • Animal free: Yes

  • For Research Use Only

Target Details

  • Target molecular weight: 18.4 kDa

Application Details

  • Application notes: Molecular Weight: 18.4 kDa UniProt number P01588

Handling

  • Storage conditions: -20°C
  • Shipping conditions: Dry Ice

Documentation

Related Tools

Product Image

Lichenase A

#153953
Product Image

N-acetylataed alpha-synuclein(NAc alphaS) protein

#161672
Product Image

a1-ORD Protein

#156500

References

  • •  Erythropoietin (EPO) is a glycoprotein growth factor that is produced primarily in the kidney in response to hypoxia or anemia. It is the principal physiological regulator of erythropoiesis. EPO promotes erythropoiesis by binding to a homodimeric cell surface receptor that activates JAK2/STAT5, PI3K/AKT, and MAPK pathways, and stimulates the proliferation and differentiation of erythroid progenitor cells.