Product Image

Contributor Information

  • Name Natasa Skoko
  • Institute International Centre For Genetic Engineering And Biotechnology (ICGEB)

Tool Details

  • Tool name: Human Insulin (INS), Recombinant Protein
  • Alternate names: Insulin, INS
  • Tool type: Proteins
  • Tool sub-type: Cytokine
  • Sequence: B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT A chain: GIVEQCCTSICSLYQLENYCN
  • Source: Pichia pastoris
  • Expression system: Recombinant
  • UniProt ID: P01308
  • Description: Two-chain polypeptide hormone produced by the ß-cells of pancreatic islets. The a and ß chains are joined by two interchain disulfide bonds. The a chain contains an intrachain disulfide bond. Insulin regulates the cellular uptake, utilization, and storage of glucose, amino acids, and fatty acids and inhibits the breakdown of glycogen, protein, and fat. Serum-free medium supplements such as insulin are essential for long-term growth of commonly used mammalian cell lines. When insulin is absent from media, cell may exhibit disturbances in morphology and growth rate.
  • Research area: Cell Signaling & Signal Transduction ; Metabolism

  • For Research Use Only

Target Details

Application Details

Handling

  • Storage conditions: -20°C
  • Shipping conditions: Dry Ice

Documentation

  • Available on request