Product Image

Contributor Information

  • Name Dr. Alistair K. Brown
  • Institute The University of Newcastle Upon Tyne

Tool Details

  • Tool name: Recombinant holo-Acyl carrier protein (holo-AcpP) from Escherichia coli
  • Tool type: Protein
  • Tool sub-type: Carrier protein
  • Sequence: MGSSHHHHHHSSGLVPRGSHMSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLG ADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
  • Source: Escherichia coli
  • Molecular weight of the target: Holo-AcpP MW (with His6-tag): 11142.84
  • Description: Activated recombinant AcpP from Escherichia coli (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpP.

  • For Research Use Only

Target Details

  • Target molecular weight: Holo-AcpP MW (with His6-tag): 11142.84

Application Details

Handling

  • Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.

Documentation

Related Tools

Product Image

Lichenase A

#153953
Product Image

Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)

#161713
Product Image

PL3 Peptide

#157666

References

  • •  Marcella et al. 2017. Applied Microbiology Biotechnology. 101(23-24): 8431-8441. PMID: 29075826