Product Image

Contributor Information

  • Name Dr. Alistair K. Brown
  • Institute The University of Newcastle Upon Tyne
  • Primary citation Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373294

Tool Details

  • Tool name: Recombinant holo-Acyl carrier protein (holo-AcpM) from Mycobacterium tuberculosis (tagged)
  • Tool type: Protein
  • Tool sub-type: Carrier protein
  • Sequence: MGSSHHHHHHSSGLVPRGSHMPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK
  • Source: Mycobacterium tuberculosis (tagged)
  • Molecular weight of the target: Holo-AcpP Mw (with His6-tag): 15027.28
  • Description: Activated recombinant AcpM from Mycobacterium tuberculosis (cleavable tag) expressed in an E.coli BL21(DE3) derivative. N-terminal His6-tagged thrombin cleavable (underlined) AcpM.

  • For Research Use Only

Target Details

  • Target molecular weight: Holo-AcpP Mw (with His6-tag): 15027.28

Application Details

Handling

  • Purity: Minimum purity: 90% by LC-MS and SDS-PAGE.

Documentation

Related Tools

Product Image

Lichenase A

#153953
Product Image

37AA - p53-derived apoptotic Peptide

#152986
Product Image

Top10 E. coli for ampicillin-resistant vector propogation of GST and human CB1 receptor (AA 414-472 ) fusion protein

#161636

References

  • •  Kremer et al. 2011. Journal of Biological Chemistry. 276(30):27967-74. PMID: 11373295